Hemolysincabind

Author: eeks

August undefined, 2024

WebMonzonetal.BMCGenomics (2024) 22:550 Page5of14 Collagen-hug binding mechanism, two domains build a trench in which the ligand docks and is finally locked. By comparing … Webcl15317 (PSSM ID: 417693): Conserved Protein Domain Family HemolysinCabind,

KEGG T06325: GXM_06899

WebA Tangled Web: Origins of Reproductive Parasitism Joseph J. Gillespie1,*, Timothy P. Driscoll 2, Victoria I. Verhoeve 2, Mohammed Sayeedur Rahman 1,KevinR. Macaluso3, … WebOverview 1 RT 1: 75140-81727 bp Neighborhood of RT #1 [75140, 81909] PRK09040 OmpA_C-like HemolysinCabind HemolysinCabind HemolysinCabind … alegrate anna batancourt midi

Protein domain repetition is enriched in Streptococcal cell …

WebPlease note: when we start each new Pfam data release, we take a copy of the UniProt sequence database. This snapshot of UniProt forms the basis of the overview that you … WebmyRT report for GCA_903917955.1_freshwater_MAG_---_Ki3-D4_bin-316 Download annotations/find similar RTs Seq: CAIXCO010000048.1 uncultured Chlorobiaceae … Web2 nov. 2015 · HemolysinCabind: Hemolysin-type calcium-binding repeat. LIM: Lin11, Isl-1 and Mec-3 domain. MIT: microtubule interacting and transport. MYA: million years ago. … alegra se

CDD Conserved Protein Domain Family: HemolysinCabind

Web21 aug. 2007 · View protein in Pfam PF00353, HemolysinCabind, 5 hits: SUPFAM i: SSF51120, SSF51120, 2 hits: PROSITE i: View protein in PROSITE PS00330, … WebIn addition, several blocks of tional file 1, section B). In the Corby strain, we distinguish tandem repeats identified as HemolysinCabind domains two different types of repeats, … alegra spanishWebThe zinc binding site/active site of EEB69635 is indicated by blue lines, with the HemolysinCabind domains in red and the matrixin domain (pfam00413) in green. (C) … alegra te

"WebKEGG Orthology (KO) [BR:nsh00001] 09100 Metabolism 09101 Carbohydrate metabolism 00562 Inositol phosphate metabolism GXM_06899 Enzymes [BR:nsh01000] 3. Hydrolases " - Hemolysincabind

Hemolysincabind

Webgenome browser: aa seq: 6481 aa aa seq db search mnkslpvvdalngfliknhpngqssiakngakvvpgeqlillsgeailhhlgvgwtalev … WebKEGG Orthology (KO) [BR:nfl00001] 09100 Metabolism 09101 Carbohydrate metabolism 00562 Inositol phosphate metabolism COO91_00480 Enzymes [BR:nfl01000] 3. Hydrolases

Did you know?

Web1 dec. 2012 · HemolysinCabind (PF00353) The SSA_1099 of S. sanguinis is the only streptococcal protein that contains HemolysinCabind domain. The protein has ten HemolysinCabind repeats, and the predicted product is the repeats-in-toxin (RTX) …

Web1 feb. 2005 · The presence of a HemolysinCabind domain, which is typically associated with T1SS toxins, agrees with pLbAR_38 being adjacent to four genes encoding an RTX … WebUniProtKB. x; UniProtKB. Protein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects.

WebDUF1542 is the highest repeated domain in a single protein, followed by Rib, CW_binding_1, G5 and HemolysinCabind. 3D structures of 24 repeat-containing … Webgenome browser: aa seq: 6481 aa aa seq db search mnkslpvvdalngfliknhpngqssiakngakvvpgeqlillsgeailhhlgvgwtalev ghpfkldgispllksvitqadienlieqavangidpipllnmleataageetplgsggdt

WebDetails of Pfam family HemolysinCabind Pfam description : Hemolysin-type calcium-binding repeat (2 copies) Click here to go to the Pfam web-site for this family. SCOP families related to this family. Z score family code family description.

WebUniProtKB. x; UniProtKB. Protein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. alegra stockton caWebEntry: HemolysinCabind LinkDB: HemolysinCabind Original site: HemolysinCabind . All links . Gene (10103) KEGG GENES (10103) Protein sequence (61520) UniProt (61457) … alegra te95WebViewers. Legend. Settings alegra tarifasWeb7-Aug-2024. Structure. ? Aligned Rows: Download Cn3D. PubMed References. pfam00353 is classified as a model that may span more than one domain. pfam00353 is the only … alegrate edelvivesWeb18 jul. 2024 · Fig. 1. Schematic representation of fibrillar adhesins domain architecture and comparison to a pilus polymer: Three well studied fibrillar adhesins from S. aureus are … alegra storeWebNodes: Network nodes represent proteins alegrate catequistaWebKEGG Orthology (KO) [BR:ddd00001] 09160 Human Diseases 09175 Drug resistance: antimicrobial 01503 Cationic antimicrobial peptide (CAMP) resistance Dda3937_04583 (prtB) alegrate cancionero